Job Check Nigeria
Jobs in Nigeria
Back to jobs
Job in Nigeria

Full Stack Engineer

Source Microfinance Bank Nigeria Type not specified Posted 2026-09-04
StateNigerCityNot specifiedContractType not specifiedPosted2026-09-04Close dateNot specifiedExperienceNot specifiedSourceJobzilla Nigeria
full stack engineerreactnestjsbankingfintechnigeriatypescriptmongodbrest apifull timesecurityinternship
Use AI for this job

AI summary

Source Microfinance Bank is hiring a Full Stack Engineer to design, develop, and maintain web applications for banking services using React and NestJS. The role involves building scalable frontend and backend systems, ensuring security and performance, and collaborating with cross-functional teams. Candidates should have strong full-stack experience, preferably in the financial industry.

  • Uses React and NestJS as primary frameworks
  • Banking/financial services domain experience preferred
  • Focus on security, performance, and regulatory compliance
  • Collaborative cross-functional team environment

AI job guide

Use this guide to check salary signals, requirements, documents, application steps and safety before you apply.

AI salary guide

Not enough public data

Not enough public salary data is available for this exact role. Before applying, prepare to ask about gross pay, benefits, contract length, probation period, transport and any allowances.

Can you qualify for this role?

  • UnclearRelated work experienceThe text mentions experience, but the exact level should be confirmed at source.
  • PreferredPractical evidence in security, internship, segurancaThe tags and summary point to skills connected with this role.
  • RequiredAvailability to work in Not specifiedThe vacancy is associated with this location.

Documents to prepare

  • Likely requiredUpdated CV
  • Role specificCover letter or short employer message
  • OptionalProfessional references
  • VerifyID or passport only after verifying the employer

Application tips for this job

  • Place your strongest Full Stack Engineer evidence in the first half of your CV.
  • In your cover letter or employer message, connect your experience to Source Microfinance Bank and the role in Not specified.
  • Add concrete examples related to security, internship, seguranca, ideally with measurable outcomes or clear responsibilities.
  • Follow the instructions from Jobzilla Nigeria; avoid sending documents to unofficial contacts or copied links.
  • Confirm the deadline, interview location and employer contact before sharing personal documents.
  • Prepare a polite question about pay, benefits and contract terms for later interview stages.

Source and safety check

  • Jobzilla Nigeria
  • Original source link available
  • Application method is clear
  • Deadline not specified
  • No major risk signal was detected in the captured text.

Never pay for interviews, shortlisting, medical checks, uniforms, or job placement. Confirm every application at the original source before sharing personal documents. Report suspicious listing.

Interview preparation

  • What experience makes you a strong fit for this Full Stack Engineer role in security, internship?
  • How have you handled responsibilities similar to those in this job post?
  • Are you available to work in Not specified under the listed contract or schedule?
  • Prepare examples with clear responsibilities, tools used and measurable outcomes.
  • Review the source and research Source Microfinance Bank before the interview.

Ask what the first priorities will be in the role and how success will be measured.

Use AI to apply better

After confirming the original source, use Career Assistant to check role fit, tailor your CV and prepare a cover letter or employer message.

Original source description

You will have the opportunity to work with cutting-edge technologies and learn from industry experts. You will also ensure the quality, performance, and security of our web solutions, as well as troubleshoot and support production issues. As a Full Stack Engineer at our bank, you will work with cross-functional teams to design, implement, and optimize both frontend and backend systems using React and NestJS as the primary frameworks. Role Description Conduct unit tests and contribute to automated testing frameworks to ensure code quality and robustness. Write clean, maintainable, and well-documented code. Document system designs, APIs, user interfaces, and implementation details. Handle data validation, error handling, and authentication/authorization mechanisms. Design, develop, and maintain web applications that provide banking services to customers and internal users. Collaborate with architects and technical leads to define scalable and secure system architecture that aligns with the bank’s requirements: and industry best practices. Provide timely support and troubleshooting assistance to resolve critical incidents. Contribute to internal knowledge sharing platforms and participate in code reviews to maintain code quality and foster a collaborative development environment. Collaborate with security teams to ensure compliance with regulatory requirements. Investigate and resolve production issues related to backend services and web applications. Ensure efficiency, reliability, and adherence to industry standards. Implement frontend user interfaces using ReactJS and other web technologies. Ensure responsiveness, usability, and accessibility across different devices and browsers. ∙Design and optimize database schemas, write efficient queries, and implement database access layers for seamless data storage and retrieval. Implement backend services, APIs, and data integration layers using NestJS as the primary framework. Implement security measures and adhere to industry standards and best practices for data protection, authentication, and authorization. Qualifications Familiarity with version control systems (e.g., Git) and Agile software development methodologies. Strong problem-solving skills and ability to analyze and debug complex web issues. Strong proficiency in front-end development using ReactJS and other web technologies. Knowledge of Angular is a plus. Experience: with MongoDB and other NoSQL databases. Knowledge of MySQL is a plus. Proficiency in JavaScript or TypeScript and knowledge of related libraries and frameworks. Proven experience: as a Full Stack Engineer or similar role, preferably within the banking or financial industry. Excellent communication and collaboration skills to work effectively within cross- functional teams. Experience: with RESTful API design and development, including authentication and authorization mechanisms. Strong proficiency in backend development using NestJS. Knowledge of Laravel is a plus. How to Apply Interested and qualified candidates should: Click here to apply online View all Jobs in Nigeria Lagos State Full Stack Engineer job vacancies in Nigeria

Never pay to apply. Always confirm the original source and watch for payment requests, sensitive document requests, or unrealistic promises.